GPCRIPDB: Pairwise Alignments

   2005, GPCRIPDB.


The pairwise alignment has been generated with the "genewise" program of the Wise2 package. The output shows the protein sequence on the first line, followed by a line indicating the similarity level of the match, followed by 4 lines representing the DNA sequence; The DNA sequence descending in triplets, each triplet being a codon. The translation of each codon is shown above it.
Between the two protein sequences a line indicating the similarity of the match is printed. "+" indicates a conservative mismatch while "- "indicates a dramatic one. Mismatches are indicated by "***" in the left column in addition to "!" at the relevant position(s).


genewise $Name: wise2-2-0 $ (unreleased release)
This program is freely distributed under a GPL. See source directory
Copyright (c) GRL limited: portions of the code are from separate copyright

Query protein:       GNAI3_MOUSE
Comp Matrix:         blosum62.bla
Gap open:            12
Gap extension:       2
Start/End            default
Target Sequence      MM38502_2
Strand:              forward
Start/End (protein)  default
Gene Paras:          human.gf
Codon Table:         codon.table
Subs error:          1e-05
Indel error:         1e-05
Model splice?        model
Model codon bias?    flat
Model intron bias?   tied
Null model           syn
Algorithm            623

genewise output
Score 192.31 bits over entire alignment
Scores as bits over a synchronous coding model

Warning: The bits scores is not probablistically correct for single seqs
See WWW help for more info.

Warning: protein length=353 (x3=1059) and cDNA length=227

GNAI3_MOUSE      247 KLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTY 
                     KLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTY 
                     KLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTY 
MM38502_2          1 attgaataaattagataactcaaagctggaaaaactaattcgtagtaat 
                     attagtgaaagtcacctttttaaaattaaataggctctgacaacgcaca 
                     agtccttccagtactactctttgacttgaaaggtaaacttaacatctac 


GNAI3_MOUSE      296 EEAAAYIQCQFEDLNRRKDTKEVYTH                        
                     EEAAAYIQCQFEDLNRRKDTKEVYTH                        
                     EEAAAYIQCQFEDLNRRKDTKEVYTH                        
MM38502_2        148 gggggtactctggcacaagaaggtac                        
                     aacccatagataataggaacaataca                        
                     agattctgcgtatgcaaatcggcctc                        


//


Button bar
F.Horn (gpcrdbcmbi.kun.nl), 24-May-2005